All Topics  
Glucagon

 

   Email Print
   Bookmark   Link






 

Glucagon



 
 
Glucagon is an important hormone
Hormone

Hormones are chemicals released by cells that affect cells in other parts of the body. Only a small amount of hormone is required to alter cell metabolism....
 involved in carbohydrate metabolism
Carbohydrate metabolism

Carbohydrate metabolism denotes the various biochemistry processes responsible for the anabolism, catabolism and interconversion of carbohydrates in life organisms....
. Produced by the pancreas
Pancreas

The pancreas is a gland Organ in the digestive system and endocrine system of vertebrates. It is both an endocrine gland , as well as an exocrine gland, secreting pancreatic juice containing Digestion enzymes that pass to the small intestine....
, it is released when the glucose
Glucose

Glucose , a monosaccharide also known as grape sugar, blood sugar, or corn sugar, is a very important carbohydrate in biology....
 level in the blood is low (hypoglycemia
Hypoglycemia

Hypoglycaemia or hypoglycemia is the medical term for a Pathology state produced by a lower than normal level of Blood glucose. The term hypoglycemia literally means "under-sweet blood" ....
), causing the liver
Liver

The liver is a vital organ present in vertebrates and some other animals; it has a wide range of functions, a few of which are detoxification, protein synthesis, and production of biochemicals necessary for digestion....
 to convert stored glycogen
Glycogen

Glycogen is a polysaccharide of glucose which functions as the secondary short term energy storage in animal cells. It is made primarily by the liver and the muscles, but can also be made by the brain and stomach....
 into glucose
Glucose

Glucose , a monosaccharide also known as grape sugar, blood sugar, or corn sugar, is a very important carbohydrate in biology....
 and release it into the bloodstream. The action of glucagon is thus opposite to that of insulin
Insulin

Insulin is a hormone with extensive effects on both metabolism and several other body systems . Insulin causes most of the body's cells to take up glucose from the blood , storing it as glycogen in the liver and muscle, and stops use of fat as an energy source....
, which instructs the body's cells to take in glucose from the blood. However, glucagon also paradoxically stimulates the release of insulin, so that newly available glucose in the bloodstream can be taken up and used by insulin-dependent tissues.
he 1920s, Kimball and Murlin studied pancreatic
Pancreas

The pancreas is a gland Organ in the digestive system and endocrine system of vertebrates. It is both an endocrine gland , as well as an exocrine gland, secreting pancreatic juice containing Digestion enzymes that pass to the small intestine....
 extracts and found an additional substance with hyperglycemic
Hyperglycemia

Hyperglycemia, hyperglycaemia, or high blood sugar is a condition in which an excessive amount of glucose circulates in the blood plasma....
 properties.






Discussion
Ask a question about 'Glucagon'
Start a new discussion about 'Glucagon'
Answer questions from other users
Full Discussion Forum



Encyclopedia


Glucagon is an important hormone
Hormone

Hormones are chemicals released by cells that affect cells in other parts of the body. Only a small amount of hormone is required to alter cell metabolism....
 involved in carbohydrate metabolism
Carbohydrate metabolism

Carbohydrate metabolism denotes the various biochemistry processes responsible for the anabolism, catabolism and interconversion of carbohydrates in life organisms....
. Produced by the pancreas
Pancreas

The pancreas is a gland Organ in the digestive system and endocrine system of vertebrates. It is both an endocrine gland , as well as an exocrine gland, secreting pancreatic juice containing Digestion enzymes that pass to the small intestine....
, it is released when the glucose
Glucose

Glucose , a monosaccharide also known as grape sugar, blood sugar, or corn sugar, is a very important carbohydrate in biology....
 level in the blood is low (hypoglycemia
Hypoglycemia

Hypoglycaemia or hypoglycemia is the medical term for a Pathology state produced by a lower than normal level of Blood glucose. The term hypoglycemia literally means "under-sweet blood" ....
), causing the liver
Liver

The liver is a vital organ present in vertebrates and some other animals; it has a wide range of functions, a few of which are detoxification, protein synthesis, and production of biochemicals necessary for digestion....
 to convert stored glycogen
Glycogen

Glycogen is a polysaccharide of glucose which functions as the secondary short term energy storage in animal cells. It is made primarily by the liver and the muscles, but can also be made by the brain and stomach....
 into glucose
Glucose

Glucose , a monosaccharide also known as grape sugar, blood sugar, or corn sugar, is a very important carbohydrate in biology....
 and release it into the bloodstream. The action of glucagon is thus opposite to that of insulin
Insulin

Insulin is a hormone with extensive effects on both metabolism and several other body systems . Insulin causes most of the body's cells to take up glucose from the blood , storing it as glycogen in the liver and muscle, and stops use of fat as an energy source....
, which instructs the body's cells to take in glucose from the blood. However, glucagon also paradoxically stimulates the release of insulin, so that newly available glucose in the bloodstream can be taken up and used by insulin-dependent tissues.

History

In the 1920s, Kimball and Murlin studied pancreatic
Pancreas

The pancreas is a gland Organ in the digestive system and endocrine system of vertebrates. It is both an endocrine gland , as well as an exocrine gland, secreting pancreatic juice containing Digestion enzymes that pass to the small intestine....
 extracts and found an additional substance with hyperglycemic
Hyperglycemia

Hyperglycemia, hyperglycaemia, or high blood sugar is a condition in which an excessive amount of glucose circulates in the blood plasma....
 properties. They described glucagon in 1923. The amino acid sequence of glucagon was described in the late-1950s. A more complete understanding of its role in physiology and disease was not established until the 1970s, when a specific radioimmunoassay
Radioimmunoassay

Radioimmunoassay is a scientific method used to test antigens without the need to use a bioassay. It was developed by Rosalyn Yalow and Solomon Berson in the 1950s....
 was developed.

Structure

Glucagon is a 29-amino acid
Amino acid

In chemistry, an amino acid is a molecule containing both amine and carboxyl functional groups. These molecules are particularly important in biochemistry, where this term refers to alpha-amino acids with the general formula H2NCHRCOOH, where R is an organic substituent....
 polypeptide. Its primary structure
Primary structure

In biochemistry, the primary structure of a biological molecule is the exact specification of its atomic composition and the chemical bonds connecting those atoms ....
 in humans is: NH2
Amine

Amines are organic compounds and functional groups that contain a base nitrogen atom with a lone pair. Amines are derivative s of ammonia, wherein one or more hydrogen atoms are replaced by organic substituents such as alkyl and aryl groups....
-His
Histidine

Histidine is one of the 20 standard amino acids present in proteins. In the nutritional sense, in humans, histidine is considered an essential amino acid, but only in children....
-Ser
Serine

Serine is an organic compound with the chemical formula hydrogenoxygen2carbonCHCH2OH....
-Gln
Glutamine

Glutamine is one of the 20 amino acids encoded by the standard genetic code. Its side chain is an amide formed by replacing the side-chain hydroxyl of glutamic acid with an amine functional group....
-Gly
Glycine

Glycine is the organic compound with the chemical formula NH2CH2COOH. It is the smallest of the 20 amino acids commonly found in proteins, coded by codons GGU, GGC, GGA and GGG....
-Thr
Threonine

Threonine is an a-amino acid with the chemical formula HO2CCHCHCH3. Its codons are ACU, ACA, ACC, and ACG. This essential amino acid is classified as Chemical polarity....
-Phe
Phenylalanine

Phenylalanine is an a-amino acid with the chemical formula HO2CCHCH2C6H5, which is found naturally in the breast milk of mammals and manufactured for food and drink products and are also sold as nutritional supplements for their reputed analgesic and antidepressant effects....
-Thr
Threonine

Threonine is an a-amino acid with the chemical formula HO2CCHCHCH3. Its codons are ACU, ACA, ACC, and ACG. This essential amino acid is classified as Chemical polarity....
-Ser
Serine

Serine is an organic compound with the chemical formula hydrogenoxygen2carbonCHCH2OH....
-Asp
Aspartic acid

Aspartic acid is an a-amino acid with the chemical formula HO2CCHCH2CO2H. The carboxylate anion of aspartic acid is known as aspartate....
-Tyr
Tyrosine

Tyrosine or 4-hydroxyphenylalanine, is one of the 20 amino acids that are used by cell to protein biosynthesis proteins. This is a non-essential amino acid and it is found in casein....
-Ser
Serine

Serine is an organic compound with the chemical formula hydrogenoxygen2carbonCHCH2OH....
-Lys
Lysine

Lysine is an a-amino acid with the chemical formula HO2CCH4NH2. This amino acid is an essential amino acid, which means that humans cannot synthesize it....
-Tyr
Tyrosine

Tyrosine or 4-hydroxyphenylalanine, is one of the 20 amino acids that are used by cell to protein biosynthesis proteins. This is a non-essential amino acid and it is found in casein....
-Leu
Leucine

Leucine is an a-amino acid with the chemical formula HO2CCHCH2CH2. It is an essential amino acid, which means that humans cannot synthesise it....
-Asp
Aspartic acid

Aspartic acid is an a-amino acid with the chemical formula HO2CCHCH2CO2H. The carboxylate anion of aspartic acid is known as aspartate....
-Ser
Serine

Serine is an organic compound with the chemical formula hydrogenoxygen2carbonCHCH2OH....
- Arg
Arginine

Arginine is an a-amino acid. The Optical isomerism is one of the 20 most common natural amino acids. Its codons are CGU, CGC, CGA, CGG, AGA, and AGG....
-Arg
Arginine

Arginine is an a-amino acid. The Optical isomerism is one of the 20 most common natural amino acids. Its codons are CGU, CGC, CGA, CGG, AGA, and AGG....
-Ala
Alanine

Alanine is an a-amino acid with the chemical formula CH3CHCOOH. The L-isomer is one of the 20 proteinogenic amino acids, i.e. the building blocks of proteins....
-Gln
Glutamine

Glutamine is one of the 20 amino acids encoded by the standard genetic code. Its side chain is an amide formed by replacing the side-chain hydroxyl of glutamic acid with an amine functional group....
-Asp
Aspartic acid

Aspartic acid is an a-amino acid with the chemical formula HO2CCHCH2CO2H. The carboxylate anion of aspartic acid is known as aspartate....
-Phe
Phenylalanine

Phenylalanine is an a-amino acid with the chemical formula HO2CCHCH2C6H5, which is found naturally in the breast milk of mammals and manufactured for food and drink products and are also sold as nutritional supplements for their reputed analgesic and antidepressant effects....
-Val
Valine

Valine is an a-amino acid with the chemical formula HO2CCHCH2. L-Valine is one of 20 proteogenic amino acids....
-Gln
Glutamine

Glutamine is one of the 20 amino acids encoded by the standard genetic code. Its side chain is an amide formed by replacing the side-chain hydroxyl of glutamic acid with an amine functional group....
-Trp
Tryptophan

Tryptophan is one of the 20 List of standard amino acids, as well as an essential amino acid in the human diet. It is encoded in the standard genetic code as the codon UGG....
-Leu
Leucine

Leucine is an a-amino acid with the chemical formula HO2CCHCH2CH2. It is an essential amino acid, which means that humans cannot synthesise it....
- Met
Methionine

Methionine is an a-amino acid with the chemical formula HO2CCHCH2CH2SCH3. This Essential amino acid is classified as nonpolar....
-Asn
Asparagine

Asparagine is one of the 20 most common natural amino acids on Earth. It has carboxamide as the side chain's functional group. It is not an essential amino acid....
-Thr
Threonine

Threonine is an a-amino acid with the chemical formula HO2CCHCHCH3. Its codons are ACU, ACA, ACC, and ACG. This essential amino acid is classified as Chemical polarity....
-COOH
Carboxyl group

A carboxyl group is a set of four atoms bonded together and present in carboxylic acids, including amino acid. Usually abbreviated as either CO2H or COOH, this set of atoms constitutes a functional group....
.

The polypeptide has a molecular weight of 3485 dalton
Atomic mass unit

The unified atomic mass unit , or dalton or, sometimes, universal mass unit, is a Units of measurement of mass used to express atomic weight and molecular masses....
s. Glucagon is a peptide (non-steroid
Steroid

A steroid is a terpenoid lipid characterized by a carbon skeleton with four fused rings, generally arranged in a 6-6-6-5 fashion.Steroids vary by the functional groups attached to these rings and the oxidation state of the rings....
) hormone.

Physiology


Production

The hormone is synthesized and secreted from alpha cell
Alpha cell

Alpha cells are endocrine system cell s in the islets of Langerhans of the pancreas. They make up 15-20% of the cells in the islets. They are responsible for synthesizing and secreting the peptide hormone glucagon, which elevates the glucose levels in the blood....
s (a-cells) of the islets of Langerhans
Islets of Langerhans

The islets of Langerhans are the regions of the pancreas that contain its endocrine cells. Discovered in 1869 by German pathological anatomist Paul Langerhans, the islets of Langerhans constitute approximately 1 to 2% of the mass of the pancreas....
, which are located in the endocrine portion of the pancreas. In rodents, the alpha cells are located in the outer rim of the islet. Human islet structure is much less segregated, and alpha cells are distributed throughout the islet.

Regulatory mechanism

Increased secretion of glucagon is caused by:
  • Decreased plasma glucose
  • Increased catecholamines - norepinephrine
    Norepinephrine

    Norepinephrine or noradrenaline is a catecholamine with dual roles as a hormone and a neurotransmitter.As a stress hormone, norepinephrine affects parts of the brain where attention and responding actions are controlled....
     and epinephrine
    Epinephrine

    Epinephrine is a hormone and neurotransmitter.Epinephrine increases the "fight or flight" response of the Sympathetic nervous system of the autonomic nervous system....
  • Increased plasma amino acids (to protect from hypoglycemia
    Hypoglycemia

    Hypoglycaemia or hypoglycemia is the medical term for a Pathology state produced by a lower than normal level of Blood glucose. The term hypoglycemia literally means "under-sweet blood" ....
     if an all protein meal is consumed)
  • Sympathetic nervous system
    Sympathetic nervous system

    The Sympathetic Nervous System is a branch of the autonomic nervous system along with the enteric nervous system and parasympathetic nervous system....
  • Acetylcholine
    Acetylcholine

    The chemical compound acetylcholine is a neurotransmitter in both the peripheral nervous system and central nervous system in many organisms including homo sapiens....
  • Cholecystokinin
    Cholecystokinin

    Cholecystokinin is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein. Cholecystokinin, previously called pancreozymin, is synthesised by I-cells in the mucosal epithelium of the small intestine and secreted in the duodenum, the first segment of the small intestine, and ca...


Decreased secretion of glucagon (inhibition) is caused by:
  • Somatostatin
    Somatostatin

    Somatostatin is a peptide hormone that regulates the endocrine system and affects neurotransmission and cell proliferation via interaction with G-protein-coupled somatostatin receptors and inhibition of the release of numerous secondary hormones....
  • Insulin
    Insulin

    Insulin is a hormone with extensive effects on both metabolism and several other body systems . Insulin causes most of the body's cells to take up glucose from the blood , storing it as glycogen in the liver and muscle, and stops use of fat as an energy source....
  • Increased free fatty acids and ketoacids into the blood
  • Increased urea
    Urea

    Urea is an organic compound with the chemical formula 2carbonoxygen.Urea is also known by the International Nonproprietary Name carbamide, as established by the World Health Organization....
     production


Function

Glucagon
Glucagon Rednblue
Glucagon helps maintain the level of glucose
Glucose

Glucose , a monosaccharide also known as grape sugar, blood sugar, or corn sugar, is a very important carbohydrate in biology....
 in the blood
Blood

Blood is a specialized bodily fluid that delivers necessary substances to the body's Cell s ? such as nutrients and oxygen ? and transports waste products away from those same cells....
 by binding to glucagon receptor
Glucagon receptor

The glucagon receptor is a 62 kDa peptide that is activated by glucagon and is a member of the G-protein coupled family of receptors, coupled to Gs alpha subunit....
s on hepatocyte
Hepatocyte

Hepatocytes make up 70-80% of the cytoplasmic mass of the liver.These cells are involved in protein synthesis, protein storage and transformation of carbohydrates, synthesis of cholesterol, bile salts and phospholipids, and detoxification, modification and excretion of exogenous and endogenous substances....
s, causing the liver
Liver

The liver is a vital organ present in vertebrates and some other animals; it has a wide range of functions, a few of which are detoxification, protein synthesis, and production of biochemicals necessary for digestion....
 to release glucose - stored in the form of glycogen
Glycogen

Glycogen is a polysaccharide of glucose which functions as the secondary short term energy storage in animal cells. It is made primarily by the liver and the muscles, but can also be made by the brain and stomach....
 - through a process known as glycogenolysis
Glycogenolysis

Glycogenolysis is the catabolism of glycogen by removal of a glucose monomer through cleavage with inorganic phosphate to produce glucose-1-phosphate....
. As these stores become depleted, glucagon then encourages the liver to synthesize additional glucose by gluconeogenesis
Gluconeogenesis

Gluconeogenesis is a metabolic pathway that results in the generation of glucose from non-carbohydrate carbon substrates such as lactic acid, glycerol, and glucogenic amino acids....
. This glucose is released into the bloodstream. Both of these mechanisms lead to glucose release by the liver, preventing the development of hypoglycemia
Hypoglycemia

Hypoglycaemia or hypoglycemia is the medical term for a Pathology state produced by a lower than normal level of Blood glucose. The term hypoglycemia literally means "under-sweet blood" ....
. Glucagon also regulates the rate of glucose production through lipolysis
Lipolysis

Lipolysis is the breakdown of fat stored in fat cells. During this process, free fatty acids are released into the bloodstream and circulate throughout the body....
.

Glucagon production appears to be dependent on the central nervous system through pathways which are yet to be defined. It has been reported that in invertebrate animals eyestalk removal can affect glucagon production. Excising the eyestalk in young crayfish produces glucagon-induced hyperglycemia.

Mechanism of action

Glucagon binds to the glucagon receptor
Glucagon receptor

The glucagon receptor is a 62 kDa peptide that is activated by glucagon and is a member of the G-protein coupled family of receptors, coupled to Gs alpha subunit....
, a G protein-coupled receptor
G protein-coupled receptor

G protein-coupled receptors , also known as seven transmembrane domain receptors, 7TM receptors, heptahelical receptors, serpentine receptor, and G protein-linked receptors , comprise a large protein family of transmembrane receptors that sense molecules outside the Cell and activate inside signal transductio...
  located in the plasma membrane. The conformation change in the receptor activates G protein
G protein

G proteins, short for guanine nucleotide-binding proteins, are a family of proteins involved in second messenger cascades.G proteins are so called because they function as "molecular switches," alternating between an inactive guanosine diphosphate and active guanosine triphosphate bound state, ultimately going on to regulate down...
s, a heterotrimeric protein with a, ß, and ? subunits. The subunits breakup as a result of substitution of a GDP molecule with a GTP mol, and the alpha subunit specifically activates the next enzyme in the cascade, adenylate cyclase
Adenylate cyclase

Adenylate cyclase is a lyase enzyme....
.

Adenylate cyclase manufactures cAMP
CAMP

CAMP may stand for:* Cyclic adenosine monophosphate * Cathelicidin* Campaign Against Marijuana Planting* Central Atlantic Magmatic Province...
 (cyclical AMP) which activates protein kinase A (cAMP-dependent protein kinase). This enzyme in turn activates phosphorylase kinase
Phosphorylase kinase

Phosphorylase kinase is a serine/threonine-specific protein kinase which converts glycogen phosphorylase b to glycogen phosphorylase a, activating it to release glucose-1-phosphate from glycogen...
, which in turn, phosphorylates glycogen phosphorylase
Glycogen phosphorylase

Glycogen phosphorylase is one of the phosphorylase enzymes . Glycogen phosphorylase catalyzes the rate limiting step in the degradation of glycogen in animals by releasing glucose-1-phosphate from the terminal alpha-1,4-glycosidic bond....
, converting into the active form called phosphorylase A. Phosphorylase A is the enzyme responsible for the release of glucose-1-phosphate
Glucose-1-phosphate

Glucose 1-phosphate is a glucose molecule with a phosphate group on the 1'-carbon....
 from glycogen
Glycogen

Glycogen is a polysaccharide of glucose which functions as the secondary short term energy storage in animal cells. It is made primarily by the liver and the muscles, but can also be made by the brain and stomach....
 polymers.

Pathology

Abnormally-elevated levels of glucagon may be caused by pancreatic tumor
Tumor

A tumor or tumour is the name for a swelling or lesion formed by an abnormal growth of cells . Tumor is not synonymous with cancer. A tumor can be Benign neoplasm, Carcinoma in situ or malignant, whereas cancer is by definition malignant....
s such as glucagonoma
Glucagonoma

A glucagonoma is a rare tumor of the alpha cells of the pancreas that results in up to a 1000-fold overproduction of the hormone glucagon. Alpha cell tumors are commonly associated with glucagonoma syndrome, though similar symptoms are present in cases of pseudoglucagonoma syndrome in the absence of a glucagon-secreting tumor....
, symptoms of which include necrolytic migratory erythema
Necrolytic migratory erythema

Necrolytic migratory erythema is a classical symptom observed in patients with glucagonoma and is present in 80% of cases....
 (NME), reduced amino acids and hyperglycemia
Hyperglycemia

Hyperglycemia, hyperglycaemia, or high blood sugar is a condition in which an excessive amount of glucose circulates in the blood plasma....
. It may occur alone or in the context of multiple endocrine neoplasia type 1
Multiple endocrine neoplasia type 1

Multiple endocrine neoplasia type 1 or Wermer syndrome is part of a group of disorders that affect the endocrine system....
.

Uses

An injectable form of glucagon is vital first aid in cases of severe hypoglycemia
Hypoglycemia

Hypoglycaemia or hypoglycemia is the medical term for a Pathology state produced by a lower than normal level of Blood glucose. The term hypoglycemia literally means "under-sweet blood" ....
 when the victim is unconscious or for other reasons cannot take glucose orally. The dose for an adult is typically 1 milligram, and the glucagon is given by intramuscular, intravenous or subcutaneous injection, and quickly raises blood glucose levels. Glucagon can also be administered intravenously at 0.25 - 0.5 unit.

Anecdotal evidence suggests a benefit of higher doses of glucagon in the treatment of overdose with beta blocker
Beta blocker

Beta blockers are a class of medication used for various indications, but particularly for the management of cardiac arrhythmias, cardioprotection after myocardial infarction , and hypertension....
s; the likely mechanism of action is the increase of cAMP in the myocardium, effectively bypassing the inhibitory action of the ß-adrenergic
Adrenergic receptor

The adrenergic receptors are a class of G protein-coupled receptors that are targets of the catecholamines. Adrenergic Receptor s specifically bind and are activated by their endogenous ligands, the catecholamines adrenaline and noradrenaline ....
 second messenger system
Second messenger system

In cell physiology, a secondary messenger system is a method of cellular signaling, whereby a diffusable signaling molecule is rapidly produced/secreted which can then go on to activate effector proteins within the cell to exert a cellular response....
.

Glucagon acts very quickly: common side effects include headache and nausea.

Drug interactions: Glucagon interacts only with oral anticoagulants increasing the tendency to bleed.

Media



See also

  • Insulin
    Insulin

    Insulin is a hormone with extensive effects on both metabolism and several other body systems . Insulin causes most of the body's cells to take up glucose from the blood , storing it as glycogen in the liver and muscle, and stops use of fat as an energy source....
  • Diabetes mellitus
    Diabetes mellitus

    Diabetes mellitus , often referred to simply as diabetes , is a syndrome of disordered metabolism, usually due to a combination of genetic disorder and environmental causes, resulting in abnormally high blood sugar levels ....
  • Proglucagon
    Proglucagon

    Proglucagon is a precursor of glucagon, and several other components. It is generated in the alpha cells of the pancreas, and it consists of the following:...
  • Glucagon-like peptide-1
    Glucagon-like peptide-1

    Glucagon-like peptide-1 is derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestine L cell that secretes GLP-1 as a gut hormone....
  • Glucagon-like peptide-2
    Glucagon-like peptide-2

    Glucagon-like peptide-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ....
  • Islets of Langerhans
    Islets of Langerhans

    The islets of Langerhans are the regions of the pancreas that contain its endocrine cells. Discovered in 1869 by German pathological anatomist Paul Langerhans, the islets of Langerhans constitute approximately 1 to 2% of the mass of the pancreas....
  • Pancreas
    Pancreas

    The pancreas is a gland Organ in the digestive system and endocrine system of vertebrates. It is both an endocrine gland , as well as an exocrine gland, secreting pancreatic juice containing Digestion enzymes that pass to the small intestine....
  • Cortisol
    Cortisol

    Cortisol is a corticosteroid hormone or glucocorticoid produced by the adrenal cortex, that is part of the adrenal gland . It is usually referred to as the "stress hormone" as it is involved in response to stress and anxiety, controlled by Corticotropin-releasing hormone....


Further reading